Protein Info for IAI46_00320 in Serratia liquefaciens MT49

Annotation: cyanate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 139 to 164 (26 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details amino acids 371 to 388 (18 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 349 (316 residues), 95 bits, see alignment E=2.3e-31

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 96% identity to spe:Spro_0106)

Predicted SEED Role

"Cyanate transport protein CynX" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>IAI46_00320 cyanate transporter (Serratia liquefaciens MT49)
MLNHFIAPPFLRRWFNPLLWVLVLIGLNMRPLLTSIGPLLPTLRQATGLSFGGAALLTTL
PVLMMGLMALAGGAINRLFSERTSVVLSLLAIGLGAAWRELAPGSTQLMLSAVLGGLGIG
VIQAVMPGIIKHHFLKQMALVAGLWSAALMGGGGLGAAITPWLMSVGHDWYSALAWWAAP
ALVALIAWWPVSRGLARLTPSGTARGPSLWFSRRAWLLGAYFGLINGGYTSLIAWLPPYY
MQLGWQPQASGSLLALMTFGQVVGALLLPALARATDRRPLLLLALIMQLAGFIGLIYLPQ
TLPWLWVLLSGLGLGGAFPLCLVLALDHIPHPAAAGRLVAFMQGIGFLLAGTTPYISGLL
RDYSGGFVLDWQIHALLVVVLIAITWCFHPHSYRRAFAE