Protein Info for IAI46_00300 in Serratia liquefaciens MT49

Annotation: DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF13407: Peripla_BP_4" amino acids 87 to 255 (169 residues), 39.3 bits, see alignment E=1.1e-13 PF13377: Peripla_BP_3" amino acids 112 to 277 (166 residues), 124.5 bits, see alignment E=9.4e-40 PF00165: HTH_AraC" amino acids 294 to 335 (42 residues), 30.5 bits, see alignment 6.2e-11 amino acids 346 to 384 (39 residues), 43.9 bits, see alignment 3.9e-15 PF12833: HTH_18" amino acids 309 to 386 (78 residues), 70.6 bits, see alignment E=2.3e-23

Best Hits

Swiss-Prot: 82% identical to XYLR_ECO57: Xylose operon regulatory protein (xylR) from Escherichia coli O157:H7

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 97% identity to spe:Spro_0102)

Predicted SEED Role

"Xylose activator XylR (AraC family)" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>IAI46_00300 DNA-binding transcriptional regulator (Serratia liquefaciens MT49)
MFEKRFRITLLFNANKVYDRQVVEGVGEYLQASQCDWDIFIEEDFRCRIDNIKDWLGDGV
IADFDDREIEHLLHNVRVPIVGVGGSYHRDEDYPPVHYIATDNQALVEAAFSHLKEKGIN
RFAFYGLPSEGGKRWAQEREHAFRQRVALEQYQGVVYQGMATAPENWQYAQNRLADWVQT
LPQQTGIIAVTDARARHLLQVCEHLDIAVPEKLCVIGIDNEELTRYLSRVALSSVAQGTR
QMGYRAAKLLHQLLDRRELPLQRILVPPVKVIERRSTDFRSLRDPAVIQAMHYIRHHACK
GIKVEQVLDAVGLSRSNLEKRFRDETGETIHHVIHQEKLDRACNLLKATSLTINEISQMC
GYPSLQYFYSVFKKGYDMTPKDYRERYGEVGY