Protein Info for IAI46_00195 in Serratia liquefaciens MT49

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details PF16591: HBM" amino acids 43 to 279 (237 residues), 56.7 bits, see alignment E=3.8e-19 PF00672: HAMP" amino acids 304 to 355 (52 residues), 34.6 bits, see alignment 2.9e-12 PF00015: MCPsignal" amino acids 418 to 573 (156 residues), 187.9 bits, see alignment E=2.2e-59

Best Hits

KEGG orthology group: K05875, methyl-accepting chemotaxis protein II, aspartate sensor receptor (inferred from 94% identity to spe:Spro_0080)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (642 amino acids)

>IAI46_00195 methyl-accepting chemotaxis protein (Serratia liquefaciens MT49)
MAALQTLAGKFVHLTVGKKLGLGFGLMLLLTAIIAGTGAQYLHTIESRADRIDFSNKLND
EINQAKYNRALFGQTYKPEYLKNNRTSIENAVKMINQGQDLDWDPQSRKDLQRLMELIGH
YQQQQNAFEKAVAAKDAVRQSWNMSEVQDSLNQVERQLTNGDLQLAFIQLNQKLTLVRYG
ARGLLLSLSSESEAPLVAAIDDARSAANALSRRLNDAQRPLLQPLLTALDDYKNRIQAYL
PAYQQEQNISQQLGNSAQEVGTLVNAFMQDELTQTHNDINAAQLQMGITTLVAIIAGLLI
AWRITLQITRPLQSTLALAERIASGDLRQAQTSTRRDELGQLLNAVAAMSQNLRDMIEKI
QMGVSQVSTAAAEIAAGNTDLSSRTEQQAAAVEETAASMEQLTATVKQNAENAHHANQLA
TDASQTAQQGGKLVESVVSTMRDISSSSQRIAEITTLINGIAFQTNILALNAAVEAARAG
EQGRGFSVVASEVRNLAQRSAQAAKEIEGLITESVSRVQTGTTLVENTGNTMEQIVLSVT
HVRDIMAEIAAASDEQTRGIAQIGQAIVEMDHTTQQNAALVEESAAAADSLEEQAEMLLQ
SVSVFRLAELSAPAAVKGTVVKAPAMKKPAASTEAEDNWTTF