Protein Info for IAI46_00190 in Serratia liquefaciens MT49

Annotation: 6-N-hydroxylaminopurine resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF03473: MOSC" amino acids 46 to 154 (109 residues), 118.7 bits, see alignment E=1.5e-38 PF03475: YiiM_3-alpha" amino acids 168 to 209 (42 residues), 48.4 bits, see alignment 7.1e-17

Best Hits

Swiss-Prot: 67% identical to YIIM_ECOLI: Protein YiiM (yiiM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to spe:Spro_0079)

MetaCyc: 67% identical to 6-hydroxyaminopurine reductase (Escherichia coli K-12 substr. MG1655)
RXN0-7398

Predicted SEED Role

"Uncharacterized protein conserved in bacteria"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>IAI46_00190 6-N-hydroxylaminopurine resistance protein (Serratia liquefaciens MT49)
MHHPEVYIGTVQPYEGGRPSGIAKRLVDGAIKLTSLGLEGDEQAEKSYHGGPDRALCHYP
REHYQHWREQFPTQAEQFSAPAFGENISTLGLTEHNVFMGDIFRWGDALIQVTQPRSPCF
KLNYHFDIDDISVLMQQSGRCGWLYRVISAGKVSGERPLELVTRSSDISVAEAIGIAWHM
PFDEEQYRRLLAVAGLSASWSKTMLTRISEHRIEDFNRRLLGR