Protein Info for IAI46_00185 in Serratia liquefaciens MT49

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF01728: FtsJ" amino acids 39 to 114 (76 residues), 23.6 bits, see alignment E=1.6e-08 PF01209: Ubie_methyltran" amino acids 41 to 140 (100 residues), 28.4 bits, see alignment E=3.5e-10 PF13489: Methyltransf_23" amino acids 44 to 172 (129 residues), 43.9 bits, see alignment E=7.7e-15 PF13847: Methyltransf_31" amino acids 45 to 139 (95 residues), 41.8 bits, see alignment E=3.5e-14 PF13649: Methyltransf_25" amino acids 50 to 137 (88 residues), 69.7 bits, see alignment E=1e-22 PF08242: Methyltransf_12" amino acids 51 to 139 (89 residues), 45.7 bits, see alignment E=3.3e-15 PF08241: Methyltransf_11" amino acids 52 to 139 (88 residues), 80.8 bits, see alignment E=3.3e-26

Best Hits

KEGG orthology group: None (inferred from 92% identity to srs:SerAS12_0037)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>IAI46_00185 class I SAM-dependent methyltransferase (Serratia liquefaciens MT49)
MTSPSHSIHHAAAAGYQANSDRYVKGRPDYPPEIAVWLRDTLGLHAGMTVIDLGAGTGKF
TPRLLETGAQVIAVEPVAQMLEKLSIALPQVKTLAGTAESIPLPDESVDAVVCAQSFHWF
ATPQALAEIKRILKPGGKLGLVWNMRDARVSWVRKLNQIVDRHEGDAPRFYTGEWRKLFP
FKGLDALQEQVFMLAHQGAAEDVIYNRVRSTSFIAALPPQQQEEVIDEIRQLVAEEEELQ
GKENLTVPYQTKAYFTTKL