Protein Info for IAI46_00105 in Serratia liquefaciens MT49

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF00356: LacI" amino acids 8 to 54 (47 residues), 39.8 bits, see alignment 6.4e-14 PF00532: Peripla_BP_1" amino acids 67 to 314 (248 residues), 75.3 bits, see alignment E=1.2e-24 PF13407: Peripla_BP_4" amino acids 68 to 316 (249 residues), 51 bits, see alignment E=3e-17 PF13377: Peripla_BP_3" amino acids 175 to 336 (162 residues), 78.2 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: None (inferred from 97% identity to spe:Spro_0061)

Predicted SEED Role

"2-ketogluconate utilization repressor PtxS" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>IAI46_00105 LacI family DNA-binding transcriptional regulator (Serratia liquefaciens MT49)
MRASGRATISDVAKTAKTGKTSVSRYLNGEQHLLSDDLKQRIEQAILQLDYRPSQMARSL
KGGQTRLIGLIIADITNPYSVDVMRGIEAACRQHGFTLLVCNTNNEVNQEQHYLQLLSSY
RVEGIVVNAVGMREEALSTLQQSMLPMVLIDRKIHDFACDVVGLNNHEAATTATEHLLQQ
GFEAILFLSEPIGTVNTRLERLHAFNQTMAQHAGLLAEQAEVPLNDVKLLEGVLGDFNTR
HRGMRKAVISANGALTLQVARAMRRLGIQWGSDIGLLGFDELEWAELAGVGITTLKQPTY
QMGHAALEQLVQRIQGLDTPISEQMFPGELIVRGSTTR