Protein Info for IAI46_00090 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 324 to 348 (25 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 375 (358 residues), 199.3 bits, see alignment E=1.3e-62 amino acids 268 to 415 (148 residues), 56.6 bits, see alignment E=3.3e-19 PF00083: Sugar_tr" amino acids 48 to 410 (363 residues), 34.2 bits, see alignment E=2.1e-12 PF11700: ATG22" amino acids 171 to 414 (244 residues), 31.7 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 97% identity to spe:Spro_0058)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>IAI46_00090 MFS transporter (Serratia liquefaciens MT49)
MTKATIAAKRWWYIMPIVFITYSLAYLDRANFSFASAAGINDDLGITKGMSSLLGALFFL
GYFFFQIPGAIYAERRSVKKLIFWCLILWGACASLTGMVSNIPMLAAIRFILGVVEAAVM
PAMLIYISNWFTKSERSRANTFLILGNPVTVLWMSVVSGYLIHAYGWREMFIFEGIPAVI
WAFCWWVLVKDKPAQAKWLSDDEKLALQQQLEEEQKGIKAVRNYSEAFRSRNVILLCVQY
FAWSIGVYGFVLWLPSILRSGMEMGMVEAGWLSAVPYLAATIAMILVSWASDKMQNRKLF
VWPLLLIGALAFFGSYAVGANHFWISYALLVIAGAAMYAPYGPFFAIIPEMLPKNVAGGA
MALINSMGALGSFFGSWFVGYLNGATGSPAASYMFMAIALLVAVVVTLIVKPARNEAHPQ
LA