Protein Info for IAI46_00060 in Serratia liquefaciens MT49

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 59 to 83 (25 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 397 to 420 (24 residues), see Phobius details amino acids 432 to 452 (21 residues), see Phobius details amino acids 464 to 485 (22 residues), see Phobius details amino acids 493 to 513 (21 residues), see Phobius details amino acids 529 to 551 (23 residues), see Phobius details PF06826: Asp-Al_Ex" amino acids 10 to 179 (170 residues), 151 bits, see alignment E=2.9e-48 amino acids 374 to 546 (173 residues), 156.3 bits, see alignment E=6.8e-50 TIGR01625: AspT/YidE/YbjL antiporter duplication domain" amino acids 16 to 166 (151 residues), 137.4 bits, see alignment E=1.7e-44 amino acids 379 to 533 (155 residues), 162.3 bits, see alignment E=3.7e-52 PF02080: TrkA_C" amino acids 294 to 359 (66 residues), 38.9 bits, see alignment E=6.3e-14

Best Hits

Swiss-Prot: 98% identical to Y050_SERP5: Putative transport protein Spro_0050 (Spro_0050) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07085, putative transport protein (inferred from 98% identity to spe:Spro_0050)

Predicted SEED Role

"Mediator of hyperadherence YidE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>IAI46_00060 putative transporter (Serratia liquefaciens MT49)
MSEIALTVSMLALVAVLGLWMGNWKLYGVGLGIGGVLFGGIIVGHFAQSWQLSLNGDMLH
FIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNGFAILLVLVGGVVAAVVHKLFDVPLP
IILGVFSGAVTNTPALGAGQQILTDLGSDPAMVDRMGMGYAMAYPFGICGILLVMWLIRL
FFRINIEREAQAFESSLGNQRELLQTMNIAVRNPNLQGMAIKNVPLLNGEDIICSRLKRG
ELLMVPAPLERLELGDYLHLVGKRESLENARLVIGEEVDVSLSTRGTELQVVRAVVTNEK
VLGSKIRDLNLKQKYDVVISRLNRAGVELVAGSNVTLQFGDILNLVGRPESIEAVAAIVG
NAQQKLQQVQMLPVFIGIGLGVLLGSVPLFIPGFPAALRLGLAGGPLVAALILGRIGSIG
KLYWFMPPSANLALRELGIVLFLAVVGLKSGGNFVDTLINGEGLAWIGYGALITAIPLLS
VGVLARMVGKMNYLTLSGMLAGSMTDPPALAFANGLHPTSGAAALSYATVYPLAMFLRIM
SPQLLAVLFWAM