Protein Info for IAI46_00025 in Serratia liquefaciens MT49

Annotation: sugar-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR00099: Cof-like hydrolase" amino acids 5 to 264 (260 residues), 230.7 bits, see alignment E=2.3e-72 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 237 (233 residues), 96 bits, see alignment E=3.4e-31 PF05116: S6PP" amino acids 5 to 74 (70 residues), 22.6 bits, see alignment E=1.1e-08 amino acids 179 to 247 (69 residues), 37.5 bits, see alignment E=3.2e-13 PF08282: Hydrolase_3" amino acids 6 to 264 (259 residues), 231.9 bits, see alignment E=1.6e-72

Best Hits

Swiss-Prot: 63% identical to YIDA_ECOL6: Sugar phosphatase YidA (yidA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07024, (no description) (inferred from 94% identity to spe:Spro_0036)

MetaCyc: 63% identical to sugar phosphatase YidA (Escherichia coli K-12 substr. MG1655)
Sugar-phosphatase. [EC: 3.1.3.23]

Predicted SEED Role

"Promiscuous sugar phosphatase YidA, haloacid dehalogenase-like phosphatase family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>IAI46_00025 sugar-phosphatase (Serratia liquefaciens MT49)
MAIELIAIDMDGTLLNPQHQITPAVKQAITEARRKGVHVVLATGRPYVGVQDYLRQLDIQ
GPGDFCITYNGALVLKAVDGACILQETLGFEDYLYFEQMARELGVHYQAFDFDTLYTPNK
DIGKYTVHESEMTGIPLKYRSVEEMDPAIRFPKLMMVDEPELLDRAIARIPAETRERYTI
LKSAPYFLEILHKNVDKGTGVKMLADHLGIAQQNVMTLGDQANDTAMIEYAGVGVAMGNA
IEELKAVAQFVTTTNTEDGVARAIEKFVLNA