Protein Info for IAI46_00005 in Serratia liquefaciens MT49

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 69.4 bits, see alignment E=4.3e-23 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 463 (458 residues), 617.8 bits, see alignment E=6.2e-190 PF00308: Bac_DnaA" amino acids 131 to 347 (217 residues), 331.8 bits, see alignment E=5.9e-103 PF01695: IstB_IS21" amino acids 166 to 268 (103 residues), 35.2 bits, see alignment E=2.4e-12 PF00004: AAA" amino acids 167 to 268 (102 residues), 27 bits, see alignment E=1.4e-09 PF08299: Bac_DnaA_C" amino acids 374 to 442 (69 residues), 112.4 bits, see alignment E=2e-36

Best Hits

Swiss-Prot: 98% identical to DNAA_SERP5: Chromosomal replication initiator protein DnaA (dnaA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 98% identity to spe:Spro_0032)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>IAI46_00005 chromosomal replication initiator protein DnaA (Serratia liquefaciens MT49)
MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNIN
GLLNDFCGTDAPLLRFEVGSKPISQIISQTVTASVSASAPSAPVARAVAPSRPSWDNAAP
QPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLL
HAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFAN
KERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETR
VAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVREA
LRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSL
PEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS