Protein Info for HUW76_10445 in Fusobacterium nucleatum SB010

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08501: Shikimate_dh_N
  • amino acids 6 to 87 (82 residues), 83 bits, E=7.5e-28

Best Hits

Swiss-Prot: 46% identical to AROE_CLOB8: Shikimate dehydrogenase (NADP(+)) (aroE) from Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 87% identity to fnu:FN0045)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• chorismate biosynthesis I (7/7 steps found)
• superpathway of L-phenylalanine biosynthesis (9/10 steps found)
• superpathway of L-tyrosine biosynthesis (9/10 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• superpathway of L-tryptophan biosynthesis (8/13 steps found)
• superpathway of aromatic amino acid biosynthesis (11/18 steps found)
• chorismate biosynthesis II (archaea) (6/12 steps found)
• superpathway of chorismate metabolism (26/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Protein Sequence (267 amino acids)

>HUW76_10445 shikimate dehydrogenase (Fusobacterium nucleatum SB010)
MRKFGLLGKKLSHSLSPLLHNTFFEDLGLKDEYKLYEVDEDKIGNFKNYMLENSIEGVNI
TVPYKKRFLDKLDYISDEAKEIGAINLLYIKDKKFYGDNTDYYGFKYTLTKNDIDVKDKK
IAIIGKGGASASVYKVLKDMGANDITFYFRKDKLSKIEFPQNIAGDIIINTTPVGMYPNV
EDNLVSKEILKNFKIAIDLIYNPIETKFLKEAKECGLKTINGMDMLIEQALKTDEILYNI
VLSTQLRKKIRKKIKKKVEEFYENNGN