Protein Info for HUW76_10395 in Fusobacterium nucleatum SB010

Annotation: 50S ribosomal protein L33

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01023: ribosomal protein bL33
  • amino acids 3 to 49 (47 residues), 62.4 bits, E=2e-21
• PF00471: Ribosomal_L33
  • amino acids 4 to 49 (46 residues), 74.3 bits, E=3.8e-25

Best Hits

Swiss-Prot: 98% identical to RL33_FUSNN: 50S ribosomal protein L33 (rpmG) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K02913, large subunit ribosomal protein L33 (inferred from 98% identity to fnu:FN2044)

Predicted SEED Role

"LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-independent"

Protein Sequence (50 amino acids)

>HUW76_10395 50S ribosomal protein L33 (Fusobacterium nucleatum SB010)
MRVQVILECTETKLRHYTTTKNKKTHPERLEMMKYNPVLKRHTLYKETKK