Protein Info for HUW76_10130 in Fusobacterium nucleatum SB010

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR03137: peroxiredoxin" amino acids 1 to 187 (187 residues), 297.6 bits, see alignment E=1.8e-93 PF00578: AhpC-TSA" amino acids 4 to 135 (132 residues), 131.4 bits, see alignment E=2.6e-42 PF08534: Redoxin" amino acids 5 to 146 (142 residues), 64.2 bits, see alignment E=1.9e-21 PF10417: 1-cysPrx_C" amino acids 158 to 183 (26 residues), 35.3 bits, see alignment (E = 1.2e-12)

Best Hits

Swiss-Prot: 59% identical to AHPC_ECOLI: Alkyl hydroperoxide reductase C (ahpC) from Escherichia coli (strain K12)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 98% identity to fnu:FN1983)

MetaCyc: 59% identical to alkyl hydroperoxide reductase, AhpC component (Escherichia coli K-12 substr. MG1655)
R4-RXN [EC: 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein C (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.4.-

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.26 or 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>HUW76_10130 peroxiredoxin (Fusobacterium nucleatum SB010)
MSLIGRKVPEFKATAFKKGEKDFITVTDKDLLGKWSVFVFYPADFTFVCPTELEDLQDHY
EDFKKEGAEVYSVSCDTAFVHKAWADHSERIKKVTYPMVADPTGFLARAFEVMIEEEGLA
LRGSFVINPEGKIVAYEVHDNGIGREAKELLRKLQGAKFVAEHGEVCPAKWQPGSETLKP
SLDLIGEL