Protein Info for HUW76_09885 in Fusobacterium nucleatum SB010

Annotation: outer membrane protein assembly factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF07244: POTRA" amino acids 25 to 94 (70 residues), 42.8 bits, see alignment E=1.5e-14 amino acids 120 to 189 (70 residues), 45 bits, see alignment E=2.9e-15 amino acids 192 to 265 (74 residues), 39.5 bits, see alignment E=1.5e-13 amino acids 292 to 353 (62 residues), 30.3 bits, see alignment 1.2e-10 PF01103: Omp85" amino acids 381 to 697 (317 residues), 204.9 bits, see alignment E=5e-64

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 93% identity to fnu:FN1911)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (697 amino acids)

>HUW76_09885 outer membrane protein assembly factor (Fusobacterium nucleatum SB010)
MKKILIAFLFVISLTSFSTMVNLPIKSIEVVNNQQVPASLIKNTLKLKEGAKFSTEALLA
DFNALKETGYFEDVVLQPTSYDGGVRIVVDVVEKENVVDLLKEKGVAVNTLREDTDKSIV
ISSVKFIGNKRVTTSELLDITQLKAGEYFSRSRVEDAQRRLLATGKFSEVKPDAQVANGK
MALSFEVVENQIVKNIVITGNHTIPTSTIMSALTTKPGSVQNYNNLREDRDKILGLYQAQ
GYTLVNITDMSTDENGTLHISIVEGIVRKIEVKKMVTKQKGNRRTPNDDVLKTKDYVIDR
EIEIQPGKIFNVKEYDATVDNLMRLGIFKNVKYEARSIPGDPEGIDLILLIDEDRTAELQ
GGVAYGSETGLMGTLSLKDSNWRGKNQEFGFTFEKSNKDYTGFALDFYDPWIKDTDRVSW
GWGAYKTSYGDEDSELFHDIDTIGFKVNIGKGLGKNFRLSIGTKAEYIKEKHESGKFRKA
NNGKWYYQEKGRWKEIEGVDDKYWLWSVYPYISYDTRNNYLNPTSGVYGKFQVEGGHAGG
YKSGNFGNVTLELRTYHRGLFKNNTFAYKVVGGIASNSTKESQKFWVGGGNSLRGYDGGF
FKGSQKLVATIENRTQINDIIGFVVFADAGRAWKQNGRDPSYTRDNDHFGHNIGTTAGVG
IRLNTPIGPLRFDFGWPVGHKMDDDGMKFYFNMGQSF