Protein Info for HUW76_09730 in Fusobacterium nucleatum SB010

Annotation: RnfABCDGE type electron transport complex subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 75 to 108 (34 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 209 to 226 (18 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details PF03116: NQR2_RnfD_RnfE" amino acids 9 to 308 (300 residues), 368.4 bits, see alignment E=1.5e-114 TIGR01946: electron transport complex, RnfABCDGE type, D subunit" amino acids 10 to 308 (299 residues), 366.3 bits, see alignment E=8.2e-114

Best Hits

KEGG orthology group: K03614, electron transport complex protein RnfD (inferred from 89% identity to fnu:FN1595)

Predicted SEED Role

"Electron transport complex protein RnfD" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>HUW76_09730 RnfABCDGE type electron transport complex subunit D (Fusobacterium nucleatum SB010)
MSTILKTGPAPHIRTAETVESVMYDVVIALIPAFAMAVYSFGVRALILTAVSVATCIATE
YIWQKILKRDIEAFDGSAILTGILFAFVVPVGMGLQYVIVGNFVAITLGKIVYGGLGHNI
FNPALIGRAFVQASWPVAITTFAYDGKAGATVLDAMKRGIPLTDSLIYEGGNQYINAFLG
QMGGCLGETSALALLIGGVYLIYKKQIDWKVPAVMIGTVFVLTWAMGANPFMQILSGGLF
LGAFFMATDMVTSPITGKGRVIFALGIGILVSLIRIKGGYPEGTAYAILIMNGVVPLIDR
YIRAKKFGGVSKNGK