Protein Info for HUW76_09665 in Fusobacterium nucleatum SB010

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01128: IspD
  • amino acids 12 to 228 (217 residues), 200.4 bits, E=3.5e-63
• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 15 to 230 (216 residues), 223.4 bits, E=1.2e-70
• PF12804: NTP_transf_3
  • amino acids 17 to 140 (124 residues), 29.8 bits, E=6.4e-11

Best Hits

Swiss-Prot: 94% identical to ISPD_FUSNN: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 94% identity to fnu:FN1580)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
• taxadiene biosynthesis (engineered) (9/13 steps found)
• methylerythritol phosphate pathway I (6/9 steps found)
• isoprene biosynthesis I (6/10 steps found)
• superpathway of ergosterol biosynthesis II (8/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Protein Sequence (231 amino acids)

>HUW76_09665 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Fusobacterium nucleatum SB010)
MYSSNSKIKKKVTFILAAAGQGKRMNLNSPKQFLDYKGEPLFYSSLKIAFDNKYIDDIII
VTNKENINFMVKYCQDKNLFSKVKYIVEGGSERQYSIYNAIKKIEDTDIVIIQDAARPFL
KDKYIEESLKILNDDCDGAIIGVKCKDTIKIIDENGIVLETPNRDNLIMVHTPQTFKFEI
LKKAHQMAEEKNILATDDASLVEMISGKVKFINGDYDNIKITVQEDLKFLK