Protein Info for HUW76_09435 in Fusobacterium nucleatum SB010

Annotation: ArsA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF02374: ArsA_ATPase" amino acids 1 to 303 (303 residues), 252.6 bits, see alignment E=1.3e-78 PF13614: AAA_31" amino acids 3 to 144 (142 residues), 41.9 bits, see alignment E=2.6e-14 PF01656: CbiA" amino acids 3 to 154 (152 residues), 29.6 bits, see alignment E=1.5e-10 PF10609: ParA" amino acids 3 to 150 (148 residues), 29.4 bits, see alignment E=1.4e-10 TIGR00345: transport-energizing ATPase, TRC40/GET3/ArsA family" amino acids 6 to 301 (296 residues), 215.5 bits, see alignment E=6.1e-68 PF17886: ArsA_HSP20" amino acids 323 to 385 (63 residues), 58.9 bits, see alignment E=7.5e-20

Best Hits

KEGG orthology group: K01551, arsenite-transporting ATPase [EC: 3.6.3.16] (inferred from 93% identity to fnu:FN1537)

Predicted SEED Role

"Arsenical pump-driving ATPase (EC 3.6.3.16)" in subsystem Arsenic resistance (EC 3.6.3.16)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.16

Use Curated BLAST to search for 3.6.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>HUW76_09435 ArsA family ATPase (Fusobacterium nucleatum SB010)
MRILIYTGKGGVGKTSIAAATAFFLANSGKKVILMSTDQAHSLGDVLDKKLNGKISQVFQ
NLDVVEIDPIEESQKVWRNLQDYLKQIISAKANDGIEIDETLLFPGLEEIFSLLKILDIY
EANEYDVMVVDCAPTGQSLSMLTYSEKLNMLADTILPMVQSINSIFGSFISKKTSVPKPR
DIVFEEFKSLVKRLTKLYEIFHKRDSTSIRIVTTPEQIVLEEARRNYTWLQLYNFNVDAV
YMNKLYPKEAMEGYFEGWENIQKDNIHLAEESFSEQKLFKLELQSGEIHGREALEKIARL
LYKTINPAEIFCQAESFKIEEVNGTRILTIHLPFAKEENISVIKEKYDIIISLLNETRRF
HLPDKLKTRKISEYSYKNGELKINMDYE