Protein Info for HUW76_09360 in Fusobacterium nucleatum SB010

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 76 to 102 (27 residues), see Phobius details amino acids 121 to 148 (28 residues), see Phobius details amino acids 187 to 215 (29 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 270 (180 residues), 106.5 bits, see alignment E=7.4e-35

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 91% identity to fnu:FN1522)

MetaCyc: 39% identical to nickel ABC transporter membrane subunit NikC (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>HUW76_09360 ABC transporter permease (Fusobacterium nucleatum SB010)
MKVTKFIKLHKQLVFFLIMALLIVLVAIFAKQIAPRDPLIAIMERPLRAPDKINLLGTDT
LGRDILSRIIYGARYSLFMTLILVAVVFILGTTLGLLAGYFGGIVDTIIMRLADMMVSFP
GIILAIAIAGLLGPSMTNAIIAISAVTWPKYARLSRSMVLKIKKELYVEAARLTGSRDKD
ILFKYILPNMVTLMLVTAISDIGALMLEISALSFLGFGAQPPIPEWGSMLNEGRTYLAKA
PWLMLYPGMAIVIVVVVFNMLGDNIKDLIDIKEEDF