Protein Info for HUW76_09335 in Fusobacterium nucleatum SB010

Annotation: 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00186: RNA methyltransferase, TrmH family, group 3
  • amino acids 2 to 233 (232 residues), 227.6 bits, E=8e-72
• PF08032: SpoU_sub_bind
  • amino acids 4 to 71 (68 residues), 27.2 bits, E=3.9e-10
• PF00588: SpoU_methylase
  • amino acids 89 to 228 (140 residues), 156.8 bits, E=4e-50

Best Hits

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 98% identity to fnu:FN1519)

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (234 amino acids)

>HUW76_09335 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB (Fusobacterium nucleatum SB010)
MERIIGINPVTEALLNKEKNIEKLELYNGLKGETVQKLKDLASKRNIKIFYTGKKIDNSQ
GVAVYISNYDYYKDFDEAYEELVGKAKSLVLILDEIQDPRNFGAIIRSAEVFKVDLIIIP
ERNSVRINETVVKTSTGAIEYVNISKVTNLSDTINKLKKLDYWVYGAAGEANINYNEEDY
PDKVVLVLGNEGSGIRKKVREHCDKLIKIPMYGQINSLNVSVASGILLSRIVNR