Protein Info for HUW76_09295 in Fusobacterium nucleatum SB010

Annotation: bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase" amino acids 1 to 198 (198 residues), 252.4 bits, see alignment E=2.9e-79 PF00926: DHBP_synthase" amino acids 6 to 197 (192 residues), 283.7 bits, see alignment E=6.1e-89 PF00925: GTP_cyclohydro2" amino acids 210 to 370 (161 residues), 232.3 bits, see alignment E=2.4e-73 TIGR00505: GTP cyclohydrolase II" amino acids 211 to 396 (186 residues), 264.2 bits, see alignment E=5.7e-83

Best Hits

Swiss-Prot: 59% identical to RIBBA_CLONN: Riboflavin biosynthesis protein RibBA (ribBA) from Clostridium novyi (strain NT)

KEGG orthology group: K14652, 3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC: 3.5.4.25 4.1.99.12] (inferred from 95% identity to fnu:FN1508)

MetaCyc: 46% identical to GTP cyclohydrolase II (Chlamydia trachomatis)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.25 or 4.1.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>HUW76_09295 bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II (Fusobacterium nucleatum SB010)
MIYKIEDVLEDIKNGIPLIIVDDENRENEGDIFVAAEKATYESVNFMATNARGLTCVPMS
SENAIRLGLDPMTARNTDAKCTAFTVSVDAKEGTTTGISIADRLTTIKKLADKNSMPSDF
TRPGHIFPLIAKDRGVLEREGHTEATVDLCKICGLAPVAVICEILKDDGTMARVPDLEIF
AKKHNLKIITIADLIKYRKKTEQLMKIDVVANMPTDSGTFKIVGFDNLIDGKEHIALVKG
DVAGKENVTVRIHSECFTGDILGSLRCDCGSQLKTAMRRIDKLGEGIILYLRQEGRGIGL
LNKLRAYNLQEEGMDTLDANLHLGFGADMRDYAVAAQMLKALGVKSIKLLTNNPLKINGL
EEYGMPVVEREEIEIEANKINKIYLKTKKERMGHLLKIE