Protein Info for HUW76_09055 in Fusobacterium nucleatum SB010

Annotation: ACT domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13291: ACT_4
  • amino acids 76 to 147 (72 residues), 30.3 bits, E=2.7e-11

Best Hits

Swiss-Prot: 95% identical to Y1487_FUSNN: UPF0735 ACT domain-containing protein FN1487 (FN1487) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K06209, chorismate mutase [EC: 5.4.99.5] (inferred from 95% identity to fnu:FN1487)

Predicted SEED Role

"ACT domain-containing protein"

MetaCyc Pathways

• superpathway of L-phenylalanine biosynthesis (9/10 steps found)
• superpathway of L-tyrosine biosynthesis (9/10 steps found)
• L-phenylalanine biosynthesis I (2/3 steps found)
• L-tyrosine biosynthesis I (2/3 steps found)
• L-phenylalanine biosynthesis II (1/4 steps found)
• L-tyrosine biosynthesis II (1/4 steps found)
• L-tyrosine biosynthesis III (1/4 steps found)
• superpathway of aromatic amino acid biosynthesis (11/18 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (1/5 steps found)
• bacilysin biosynthesis (1/10 steps found)
• salinosporamide A biosynthesis (3/15 steps found)
• superpathway of chorismate metabolism (26/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.5

Use Curated BLAST to search for 5.4.99.5

Protein Sequence (153 amino acids)

>HUW76_09055 ACT domain-containing protein (Fusobacterium nucleatum SB010)
MAIRNKDKDNKEFYIVDKRILPKSIQNVIKVNDLILKTKMSKYSAIKKVGISRSTYYKYK
DFIKPFYEGGEDRIYSLHLSLKDRVGILSDVLDVIAREKISILTVVQNMAVDGVAKSTIL
IKLSESMQKKIDKIISKIGNVEGIADIRITGSN