Protein Info for HUW76_08885 in Fusobacterium nucleatum SB010

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF01820: Dala_Dala_lig_N" amino acids 2 to 45 (44 residues), 34.6 bits, see alignment 8.7e-12 amino acids 52 to 85 (34 residues), 35.3 bits, see alignment 5.3e-12 TIGR01205: D-alanine--D-alanine ligase" amino acids 2 to 284 (283 residues), 251.5 bits, see alignment E=4.9e-79 PF02655: ATP-grasp_3" amino acids 95 to 253 (159 residues), 58.1 bits, see alignment E=4.2e-19 PF08443: RimK" amino acids 111 to 261 (151 residues), 41.5 bits, see alignment E=4.1e-14 PF07478: Dala_Dala_lig_C" amino acids 112 to 280 (169 residues), 132.4 bits, see alignment E=5.6e-42 PF02222: ATP-grasp" amino acids 114 to 252 (139 residues), 29.3 bits, see alignment E=2.3e-10

Best Hits

Swiss-Prot: 92% identical to DDL_FUSNN: D-alanine--D-alanine ligase (ddl) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 92% identity to fnu:FN1454)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>HUW76_08885 D-alanine--D-alanine ligase (Fusobacterium nucleatum SB010)
MKIAVFMGGTSSEKEISLKSGEAVLESLKKQGYDAYGVVLDERNQVTAFLDNEYDLAYLV
LHGGNGENGKIQAVLDILGKKYTGSGVLASAITMDKDKTKQIAQSVGIRVPKAYRTVEEI
ERFPVIIKPVDEGSSKGVFLCNNREEAEEAVKKLARPIIEDYIVGEELTVGVLNGKALGV
LKIIPQADVLYDYDSKYADGGSIHEFPAKIEDKSYKEAMKIAEKVHSEFGMKGISRSDFI
LSDGELYFLEVNSSPGMTKTSLIPDLATLKGYTFDDVVRITVETFLK