Protein Info for HUW76_08885 in Fusobacterium nucleatum SB010

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 2 to 284 (283 residues), 251.5 bits, E=4.9e-79
• PF01820: Dala_Dala_lig_N
  • amino acids 52 to 85 (34 residues), 35.7 bits, 4.1e-12
• PF02655: ATP-grasp_3
  • amino acids 95 to 253 (159 residues), 58.1 bits, E=4.2e-19
• PF08443: RimK
  • amino acids 111 to 261 (151 residues), 41.5 bits, E=4.1e-14
• PF07478: Dala_Dala_lig_C
  • amino acids 112 to 280 (169 residues), 132.4 bits, E=5.6e-42

Best Hits

Swiss-Prot: 92% identical to DDL_FUSNN: D-alanine--D-alanine ligase (ddl) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 92% identity to fnu:FN1454)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Protein Sequence (287 amino acids)

>HUW76_08885 D-alanine--D-alanine ligase (Fusobacterium nucleatum SB010)
MKIAVFMGGTSSEKEISLKSGEAVLESLKKQGYDAYGVVLDERNQVTAFLDNEYDLAYLV
LHGGNGENGKIQAVLDILGKKYTGSGVLASAITMDKDKTKQIAQSVGIRVPKAYRTVEEI
ERFPVIIKPVDEGSSKGVFLCNNREEAEEAVKKLARPIIEDYIVGEELTVGVLNGKALGV
LKIIPQADVLYDYDSKYADGGSIHEFPAKIEDKSYKEAMKIAEKVHSEFGMKGISRSDFI
LSDGELYFLEVNSSPGMTKTSLIPDLATLKGYTFDDVVRITVETFLK