Protein Info for HUW76_08420 in Fusobacterium nucleatum SB010

Annotation: thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00303: Thymidylat_synt
  • amino acids 8 to 275 (268 residues), 249.8 bits, E=1.4e-78
• TIGR03284: thymidylate synthase
  • amino acids 101 to 275 (175 residues), 132.7 bits, E=7.5e-43

Best Hits

Swiss-Prot: 97% identical to TYSY_FUSNN: Thymidylate synthase (thyA) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 97% identity to fnu:FN0240)

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (7/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)
• dTMP de novo biosynthesis (mitochondrial) (2/3 steps found)
• folate transformations III (E. coli) (6/9 steps found)
• folate transformations II (plants) (7/11 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)
• pyrimidine deoxyribonucleosides salvage (1/5 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Protein Sequence (275 amino acids)

>HUW76_08420 thymidylate synthase (Fusobacterium nucleatum SB010)
MKARFDKIYKDIVDTIAEKGIWSKGNVRTKYADGTAAYYKSYIGYQFRLDNSDDEAHLIT
SRFAPSKAPIRELYWIWILQSNDVDVLDKLGCKFWDEWKMQDGTIGKAYGYQIAQETFGQ
KSQLHYVINELKNNPNSRRIMTEIWIPNELSEMALTPCVHLTQWSVIGNKLYLEVRQRSC
DVALGLVANVFQYSVLHKLVALECGLEPAEIIWNIHNMHIYDRHYDKLIEQVNRETFEPA
KIKINNFKSIFDFKPDDVEILDYKYGEKVSYEVAI