Protein Info for HUW76_08240 in Fusobacterium nucleatum SB010

Annotation: methionine gamma-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01328: methionine gamma-lyase
  • amino acids 8 to 394 (387 residues), 622.4 bits, E=1.5e-191
• PF01053: Cys_Met_Meta_PP
  • amino acids 10 to 393 (384 residues), 527.4 bits, E=3.1e-162
• PF06838: Met_gamma_lyase
  • amino acids 50 to 233 (184 residues), 32.5 bits, E=7.2e-12
• PF00155: Aminotran_1_2
  • amino acids 63 to 233 (171 residues), 38.1 bits, E=2.2e-13
• PF00266: Aminotran_5
  • amino acids 90 to 215 (126 residues), 25.6 bits, E=1.2e-09

Best Hits

Swiss-Prot: 96% identical to MEGL_FUSNN: L-methionine gamma-lyase (FN1419) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 96% identity to fnu:FN1419)

MetaCyc: 56% identical to methionine gamma-lyase (Pseudomonas deceptionensis)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

• L-threonine degradation I (6/6 steps found)
• L-methionine degradation II (3/3 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• L-isoleucine biosynthesis I (from threonine) (3/7 steps found)
• superpathway of L-threonine metabolism (10/18 steps found)
• superpathway of L-isoleucine biosynthesis I (6/13 steps found)
• hypoglycin biosynthesis (3/14 steps found)
• superpathway of branched chain amino acid biosynthesis (4/17 steps found)
• superpathway of seleno-compound metabolism (5/19 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Protein Sequence (395 amino acids)

>HUW76_08240 methionine gamma-lyase (Fusobacterium nucleatum SB010)
MEMKKLGLGTTAIHAGTLKNLYGTLAMPIYQTSTFIFDSAEQGGRRFALEEAGYIYTRLG
NPTTTVLENKIAALEEGEAGIAMSSGMGAISSTLWTVLKAGDHVVTDKTLYGCTFALMNH
GLTKFGVEVTFVDTSNLDEVKKAMKENTRVVYLETPANPNLKIVDLEGVCKVAHTNPNTL
VIVDNTFATPYMQKPLKLGVDVVVHSATKYLNGHGDVIAGLVVTNKELADQIRFVGLKDM
TGAVLGPQEAYYIIRGLKTFEIRMERHCKNARTIADFLNKHPKVEKVYYPGLESHPGYEI
AKKQMKDFGAMISFELKGGFEAGKTLLNNLKLCSLAVSLGDTETLIQHPASMTHSPYTKE
EREAAGITDGLVRLSVGLENVEDIIADLEQGLEKI