Protein Info for HUW76_08120 in Fusobacterium nucleatum SB010

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00106: adh_short" amino acids 9 to 197 (189 residues), 173.2 bits, see alignment E=7.2e-55 PF08659: KR" amino acids 12 to 176 (165 residues), 43.4 bits, see alignment E=5.6e-15 PF13561: adh_short_C2" amino acids 15 to 231 (217 residues), 127.2 bits, see alignment E=1.2e-40

Best Hits

Swiss-Prot: 42% identical to YI13_SCHPO: NADP-dependent 3-hydroxy acid dehydrogenase (SPAC521.03) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 99% identity to fnu:FN1433)

MetaCyc: 36% identical to sulfoacetaldehyde reductase (NADPH) (Klebsiella oxytoca TauN1)
RXN-12148 [EC: 1.1.1.313]

Predicted SEED Role

"COG0300: Short-chain dehydrogenases of various substrate specificities"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.313

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>HUW76_08120 SDR family NAD(P)-dependent oxidoreductase (Fusobacterium nucleatum SB010)
MEENRVKGKIAFISGASSGIGKATAEKLAQMGVNLILCARRENILNELKENLEKQYGIKV
KNLVFDVRNYDDVLKNINSLDDEWKKIDILVNNAGLAVGLEKFYEYNMEDVDKMVDTNIK
GFVYIANTIIPLMLATDKVCTIVNIGSVAGEIAYPNGSIYCATKFAVRAISDAMRSELID
KKIKVTNIKPGLVDTGFSLVRFRGDKEKADNVYKGIDPLYAEDIADTVAYIVNLPEKIQI
TDLSITPLHQANAIHIYKEK