Protein Info for HUW76_08120 in Fusobacterium nucleatum SB010

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 9 to 197 (189 residues), 173.2 bits, E=7.2e-55
• PF08659: KR
  • amino acids 12 to 176 (165 residues), 43.4 bits, E=5.6e-15
• PF13561: adh_short_C2
  • amino acids 15 to 231 (217 residues), 127.2 bits, E=1.2e-40

Best Hits

Swiss-Prot: 42% identical to YI13_SCHPO: NADP-dependent 3-hydroxy acid dehydrogenase (SPAC521.03) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 99% identity to fnu:FN1433)

MetaCyc: 36% identical to sulfoacetaldehyde reductase (NADPH) (Klebsiella oxytoca TauN1)
RXN-12148 [EC: 1.1.1.313]

Predicted SEED Role

"COG0300: Short-chain dehydrogenases of various substrate specificities"

MetaCyc Pathways

• sulfoacetaldehyde degradation III (1/1 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.313

Protein Sequence (260 amino acids)

>HUW76_08120 SDR family NAD(P)-dependent oxidoreductase (Fusobacterium nucleatum SB010)
MEENRVKGKIAFISGASSGIGKATAEKLAQMGVNLILCARRENILNELKENLEKQYGIKV
KNLVFDVRNYDDVLKNINSLDDEWKKIDILVNNAGLAVGLEKFYEYNMEDVDKMVDTNIK
GFVYIANTIIPLMLATDKVCTIVNIGSVAGEIAYPNGSIYCATKFAVRAISDAMRSELID
KKIKVTNIKPGLVDTGFSLVRFRGDKEKADNVYKGIDPLYAEDIADTVAYIVNLPEKIQI
TDLSITPLHQANAIHIYKEK