Protein Info for HUW76_08105 in Fusobacterium nucleatum SB010

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 242 to 269 (28 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 38 to 292 (255 residues), 133 bits, see alignment E=5.8e-43

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 94% identity to fnu:FN1430)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>HUW76_08105 branched-chain amino acid ABC transporter permease (Fusobacterium nucleatum SB010)
MDKNKKLSYIITYVLLIVLYFILFSLISSGFISRYQVGILILILINIILAASLNITVGCL
GQITLGHAGFMSIGAYTAALLTKSGFLSGYQGYIVALIIGGLVAGVIGFIIGIPALRLTG
DYLAIITLAFGEIIRVLIEYFKFTGGAQGLTGIPRVNNFTLIYVITIFSVIFMYSIMTSR
HGRAVLAIREDEIASGASGINTTYYKTFAFVLSAIFAGIAGGIYAHNLGILGAKQFDYNY
SINILVMVVLGGMGSFTGSILSAVVLTILPEVLRSFAEYRMIVYPLILIIMMLFRPQGLL
GRKEFQISKVISYFTKKRGEENGK