Protein Info for HUW76_08095 in Fusobacterium nucleatum SB010
Annotation: ABC transporter ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 39% identical to LIVF_METJA: Probable branched-chain amino acid transport ATP-binding protein LivF (livF) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 93% identity to fnu:FN1428)Predicted SEED Role
"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (237 amino acids)
>HUW76_08095 ABC transporter ATP-binding protein (Fusobacterium nucleatum SB010) MAMLEVKDLQVFYDNIQALRGVSLEINEGEVVSIIGANGAGKTTTLQTISGLISPKSGSI NFEGKNLLKEKANNICKLGIAQVPEGRRIFSQLAVKDNLKLGQFTVKDTVENKEKDRANF YKIFPRMSERKNQSAGTLSGGEQQMLAMGRALMSRPKLLILDEPSMGLSPLFVKEIFEVI KQLKERGTTILLVEQNAKMALSISDRAYVIETGKIVLEGKAKDLLYNDKVKKAYLGG