Protein Info for HUW76_08060 in Fusobacterium nucleatum SB010

Annotation: NAD(+)/NADH kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01513: NAD_kinase
  • amino acids 42 to 100 (59 residues), 52.5 bits, E=6.3e-18
• PF20143: NAD_kinase_C
  • amino acids 120 to 245 (126 residues), 109.1 bits, E=1.2e-35

Best Hits

Swiss-Prot: 85% identical to NADK_FUSNN: NAD kinase (nadK) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 85% identity to fnu:FN0267)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

• NADP biosynthesis (1/1 steps found)
• NAD phosphorylation and transhydrogenation (1/2 steps found)
• NAD phosphorylation and dephosphorylation (1/3 steps found)
• cytosolic NADPH production (yeast) (2/5 steps found)
• mitochondrial NADPH production (yeast) (1/5 steps found)
• NAD(P)/NADPH interconversion (1/6 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (2/8 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Protein Sequence (267 amino acids)

>HUW76_08060 NAD(+)/NADH kinase (Fusobacterium nucleatum SB010)
MIKLSIIYNKDKEDAIKIYKELLKYLKSKKKFEILDDKKLSQVEYMVVIGGDGTLLRSFK
NIKNKEIKIIAINSGTLGYLTEIRKDKYKGIFENILKGKINIEERHFLTISIGKKTYNAL
NEVFLTKDSIKRNIISSEIYVNDKFLGKFKGDGVIIATPTGSTAYSLSAGGPIITPELKL
FLITPIAPHNLNTRPIILSGDVKIVLTISKPSEVGFINIDGNTHHKIKVEDKVEICYSTE
SLKIVIPEARNYYDVLREKLKWGENLC