Protein Info for HUW76_08055 in Fusobacterium nucleatum SB010

Annotation: DNA repair protein RecN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 TIGR00634: DNA repair protein RecN" amino acids 6 to 557 (552 residues), 526.1 bits, see alignment E=7.1e-162 PF13175: AAA_15" amino acids 6 to 501 (496 residues), 35.6 bits, see alignment E=1.2e-12 PF02463: SMC_N" amino acids 7 to 512 (506 residues), 49.6 bits, see alignment E=5.4e-17 PF13476: AAA_23" amino acids 9 to 221 (213 residues), 47.7 bits, see alignment E=4.6e-16

Best Hits

KEGG orthology group: K03631, DNA repair protein RecN (Recombination protein N) (inferred from 93% identity to fnu:FN0268)

Predicted SEED Role

"DNA repair protein RecN" in subsystem DNA-replication or DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (559 amino acids)

>HUW76_08055 DNA repair protein RecN (Fusobacterium nucleatum SB010)
MGRKLMLRELKIENLAIIDELDIEFEKGFIVLTGETGAGKSIILSGINLLIGEKASVDMI
RDGEENLVAQGVFDVDEEQKKKLEAMGIDIDGDEIIIRRSYSRSGKARAFVNNVRITLAD
LKEIASTLVDIVGQHSHQMLLNKNNHIKLLDSFLNKDEKDLKENLVSLLSQYREINTKIE
NIEREKKETLEKKEFYEYQLEEIEKLKLKDGEDEILEAEYKRVFNAEKIREKVYESLEYL
KDDDDDSALSLITNSIKNIEYLGKYDERYIELAKRMENAYYELEDCANEIEDISKGIDVT
ESDLDKIAGRMNTLKRIKEKYKRTLPELIAYREDLKEKLSDIDSGDFKTRELKQELAKIK
SEYDKLAEKLSNSRKEIAVKIENELLNELKFLNMEDANLKVQINKIEKMTNDGYDEVEFF
ISTNVGQDLKPLSKIASGGEVSRVMLALKVIFSKVDNIPILIFDEIDTGIGGETVRKIAL
KLKEIGENTQIISITHSPVIASKASQQFYIEKYVENSKTISRVKKLSPDERIKEIGRMLV
GEKINDKVLEIANKMLNEG