Protein Info for HUW76_08030 in Fusobacterium nucleatum SB010

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 20 to 48 (29 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 156 to 157 (2 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 113 (99 residues), 61.2 bits, see alignment E=5.4e-21 PF00528: BPD_transp_1" amino acids 38 to 224 (187 residues), 54.5 bits, see alignment E=6.6e-19

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 60% identity to bpb:bpr_I2464)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>HUW76_08030 amino acid ABC transporter permease (Fusobacterium nucleatum SB010)
MLSTAIDLLSKGTNFERLLYGLWVTIKLSLISAIFSIIFGILFGLFMVIKNPITKIISQI
YLQAIRIMPPLVLLFIAYFGVTRIYGVHISAEASAITIFTIWGTAEMGDLVRGSIESIPK
SQIESAIALALDKKQIYLYVIIPQIIRRLIPLSVNLITRMIKTTSLVVLIGIVEVLKVGQ
QIIDTNRFQYPSGAIWIYGVIFLLYFLSCWPLSILAKFLEKRWSKI