Protein Info for HUW76_07955 in Fusobacterium nucleatum SB010

Annotation: 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF01029: NusB" amino acids 1 to 121 (121 residues), 94.6 bits, see alignment E=3e-30 TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase" amino acids 5 to 431 (427 residues), 329.2 bits, see alignment E=2.4e-102 PF17125: Methyltr_RsmF_N" amino acids 142 to 230 (89 residues), 27.6 bits, see alignment E=1.6e-09 PF01135: PCMT" amino acids 220 to 318 (99 residues), 26.6 bits, see alignment E=2.3e-09 PF01189: Methyltr_RsmB-F" amino acids 237 to 430 (194 residues), 181.4 bits, see alignment E=7.9e-57 PF02475: Met_10" amino acids 239 to 323 (85 residues), 25.9 bits, see alignment E=3.5e-09 PF01209: Ubie_methyltran" amino acids 239 to 316 (78 residues), 21 bits, see alignment E=8.4e-08 PF01728: FtsJ" amino acids 241 to 399 (159 residues), 43.5 bits, see alignment E=1.5e-14 PF13847: Methyltransf_31" amino acids 243 to 383 (141 residues), 47.9 bits, see alignment E=5.9e-16 PF13649: Methyltransf_25" amino acids 245 to 316 (72 residues), 29.7 bits, see alignment E=4e-10

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 91% identity to fnu:FN0313)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>HUW76_07955 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB (Fusobacterium nucleatum SB010)
MNVKQVAINLISQVDKGAYSNIALNETFKTLDINSKEKTFITEIFYGVLRNKKFLDYIIE
RYTKEIKKEWIRNLLRISIYQITFMNSDDKGVVWEATELVKKKYGMTISKFINGTLRNYL
RNKDTELKRLDDEKNYEVLYSIPKWFYDILEKQYGDNNLKKAITSLKKIPYLSVRVNKLK
YSEEEFEEFLKEKDIQIIKKVDTVYYVNSGLIINSEEFKTGKIIAQDASSYLAAKNLSVM
PNELVLDICAAPGGKTAVLAEQMENKGEIIAIDIHQHKIKLIETNMKKLGIDIVKAIVMD
ARNVNKQGRKFDKILVDVPCSGYGVIRKKPEILYSKNRENIEELAKLQLEILNSAADILK
NGGELVYSTCTITDKENTDNIEKFLKERKEFKVEKLYIPENISGDYDKLGGFCINYKEEI
MDNFYIIKLKKGEKC