Protein Info for HUW76_07220 in Fusobacterium nucleatum SB010

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 299 to 329 (31 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details PF12704: MacB_PCD" amino acids 18 to 222 (205 residues), 67.6 bits, see alignment E=1.9e-22 PF02687: FtsX" amino acids 258 to 380 (123 residues), 72.4 bits, see alignment E=3.2e-24

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 99% identity to fnu:FN0581)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>HUW76_07220 ABC transporter permease (Fusobacterium nucleatum SB010)
MIEFFIAKKQMFERKKQSILSIVGVFIGITVLIVSLGVSNGLDKNMINSILSLTSHITVY
SPENISDYEKISKEIETIKGVKGVVPTIETQGIVKYEGGIEPYVAGVKVVGYDLEKAVKT
MNLDKYIIDGKIDLEDKKAVLIGNELAKATGAKVGDKIKLITSEETDLEMNVAGIFQSGF
YEYDINMVLIPLTTAQYITYSDNTVGRLSVRLDNPYDAQKLVLDVARKLPETFYIGTWGE
QNKALLSALTLEKTIMLVVFSLIAIVAGFLIWITLNTLVREKTKDIGIMRAMGFSKKNIM
LIFLIQGIILGIIGIILGIIVSLILLYYIKNYAVDLVSNIYYLKDIPIEISLKEIAIIVG
ANFIVILISSIFPAYRAARLENVEALRYE