Protein Info for HUW76_07080 in Fusobacterium nucleatum SB010

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 22 to 170 (149 residues), 126.2 bits, E=1.5e-40

Best Hits

Swiss-Prot: 57% identical to YVRO_BACSU: Uncharacterized ABC transporter ATP-binding protein YvrO (yvrO) from Bacillus subtilis (strain 168)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 98% identity to fnu:FN0827)

MetaCyc: 47% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"ABC transporter ATP-binding protein"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Protein Sequence (220 amino acids)

>HUW76_07080 ABC transporter ATP-binding protein (Fusobacterium nucleatum SB010)
MIITVDNINKTYKNGSLELQVLKNISFKVDKGEFLAIMGSSGSGKSTMMNILGCLDNQYE
GRYILDGIDISKSTENELSEIRNKKIGFIFQSFNLLPRLTALENVELPLVYSSIPKEERH
KRANELLEMVGLKERIHHRPNELSGGQRQRVAIARALANNPSIILADEPTGNLDSKSEEE
IIEILQKLNKMGKTIVIVTHEPSIGEIAERKIVFKDGEII