Protein Info for HUW76_07055 in Fusobacterium nucleatum SB010

Annotation: shikimate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF01202: SKI" amino acids 11 to 165 (155 residues), 152.9 bits, see alignment E=8.1e-49

Best Hits

Swiss-Prot: 95% identical to AROK_FUSNN: Shikimate kinase (aroK) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 95% identity to fnu:FN0822)

MetaCyc: 37% identical to shikimate kinase 1 (Escherichia coli K-12 substr. MG1655)
Shikimate kinase. [EC: 2.7.1.71]

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>HUW76_07055 shikimate kinase (Fusobacterium nucleatum SB010)
MKDNIALIGFMGSGKTTVGKLLAKTMDMKFVDIDKVIEAHEKKSINDIFHEKGQIYFRDL
EREVILQESLKNDCVIATGGGSILDNENIKRLKETSFIVFLNATIKCLYLRLKDSTTRPI
LNDAVDKRKLIEELLEKRKFLYQMSADHIIDINEYTNIYETVDKIKEAYIIS