Protein Info for HUW76_06960 in Fusobacterium nucleatum SB010

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01166: cobalt ABC transporter, ATP-binding protein
  • amino acids 16 to 203 (188 residues), 229.7 bits, E=1e-72
• PF00005: ABC_tran
  • amino acids 23 to 171 (149 residues), 110.2 bits, E=1.3e-35
• PF13304: AAA_21
  • amino acids 143 to 203 (61 residues), 31.5 bits, E=1.8e-11

Best Hits

Swiss-Prot: 50% identical to ECFA_METJA: Energy-coupling factor transporter ATP-binding protein EcfA (ecfA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 61% identity to ckl:CKL_3426)

Predicted SEED Role

"ATPase component CbiO of energizing module of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Protein Sequence (281 amino acids)

>HUW76_06960 ATP-binding cassette domain-containing protein (Fusobacterium nucleatum SB010)
MNEEYILEVKDLEYTYGDGTCALKGVNLKIEKGKKIAIIGVNGSGKSTLFLNMNGVLKAT
KGEIYFKDKKIAYDKKSLMELRKKIGIVFQNPETMLFSSNVYQEVSFGAINLKLDNNIVR
ERVQAALKDVNMTEYSEKSIHFLSYGQKKRVSIADILVMEPELIIFDEPTSSLDPRHSKK
IKEIFDELNKKGMTVIISTHDMNFTYSWADYIFVLGDGKVKKQGTPEEIFADDKILEECY
LERPFLFDMFEKLKEKNLLTKTDMKIYPKTREELYKLLKTI