Protein Info for HUW76_06920 in Fusobacterium nucleatum SB010

Annotation: basic amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00497: SBP_bac_3" amino acids 30 to 242 (213 residues), 218.5 bits, see alignment E=1.2e-68 PF10613: Lig_chan-Glu_bd" amino acids 43 to 116 (74 residues), 35.4 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 39% identical to GLNH_ECOL6: Glutamine-binding periplasmic protein (glnH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 95% identity to fnu:FN0800)

MetaCyc: 39% identical to L-glutamine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>HUW76_06920 basic amino acid ABC transporter substrate-binding protein (Fusobacterium nucleatum SB010)
MKKFFKLMLMSLLSVVISISVFAKSNVVYVGTNAEFAPFEYLEKNKIVGFDIDLLDAISK
ETGLEFKIQDMAFDGLLPALQTKKIDMVIAGMSATPEREKAVAFSKPYFKAKQVVITKGV
DKSLKSFKDLAGKKVGVMLGFTGDTVVSKIKGVKIERFNAAYAAILALSQNKVDAVVLDS
EPAKKYTANNKQFVIANIPAEEEDYAIAFRKNDKELINKVNVALDKIKANGEYDKILKKY
FK