Protein Info for HUW76_05140 in Fusobacterium nucleatum SB010

Annotation: TrkH family potassium uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 304 to 319 (16 residues), see Phobius details amino acids 332 to 357 (26 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 453 to 474 (22 residues), see Phobius details PF02386: TrkH" amino acids 47 to 475 (429 residues), 209.9 bits, see alignment E=2.8e-66

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 96% identity to fnu:FN0993)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>HUW76_05140 TrkH family potassium uptake protein (Fusobacterium nucleatum SB010)
MNTKIISYVISNLFKILMFLFLFPLAVSIYYKEGLKFSMAYIIPIIILCILSYFLSDKTP
ENQSFFSKEGLVIVSLSWLLISFFGALPFIISGSIPNMVDAFFESVSGFTTTGASILSEV
ESLSKSILFWRSFTHVVGGMGVLVLVLAILPKGNNQALHIMRAEVPGPTVGKIVAKMNYN
SRILYIIYISMIIILIIFLLLGGMPLFDACIHAFGTAGTGGFSCKNTSIGFYNSAYIDYV
TSVGMIAFGLNFNLFYLLILGNIKQVFKSEEARYYLSIIFIATTLICLNIRPFYSSISRM
IRDVFFTVSSIITTTGFSTVDFDKWPTFSKTILMFLMFCGACAGSTAGGFKVSRLVILIK
RFVREFKKIGHPNKVLNIKLEGKTLDKDMLEGVDSYFILYSVILFILLLITAWDSDSFIT
ALSAVLATFNNIGPGLGAVGPTSNFASYSAFTKIVLSLGMLLGRLEIIPLLILVSPRIYR
KRD