Protein Info for HUW76_05115 in Fusobacterium nucleatum SB010

Annotation: biotin synthase BioB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00433: biotin synthase
  • amino acids 67 to 359 (293 residues), 384 bits, E=2.4e-119
• PF04055: Radical_SAM
  • amino acids 99 to 259 (161 residues), 77 bits, E=2.1e-25
• PF06968: BATS
  • amino acids 270 to 359 (90 residues), 88.6 bits, E=2.5e-29

Best Hits

Swiss-Prot: 94% identical to BIOB_FUSNN: Biotin synthase (bioB) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 94% identity to fnu:FN1000)

MetaCyc: 34% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (4/4 steps found)
• biotin biosynthesis II (5/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Protein Sequence (360 amino acids)

>HUW76_05115 biotin synthase BioB (Fusobacterium nucleatum SB010)
MLKEKNSAGGGKFNFFNFLKEKENNQAEPINVKEFIPYLKNKIINDKYEITREEAIFLSQ
IPNNDMETLNILFDAADQIREAFCGKYFDLCTIINAKSGKCSENCKYCAQSVHFKTGADV
YGLISKELALYEAKKNENEGAHRFSLVTSGRGLNGNEKELDKLVEIYKYIGMHTGKLKLC
ASHGICTKEALQKLADAGVTTYHHNLESSRRFYPNVCTSHTYDDRVNTIKNAKAVGLNVC
SGGIFGLGETIEDRIDMALDLRTLDIHSVPINVLTPIPGTPFENNEEVNPFEILKTISIY
RFILPKAFLRYCGGRIKLGEHARTGLRCGINSALTGNFLTTTGTTIETDKKMIKELGYEI