Protein Info for HUW76_05010 in Fusobacterium nucleatum SB010

Annotation: 3-hydroxybutyryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02737: 3HCDH_N" amino acids 2 to 178 (177 residues), 211 bits, see alignment E=1.3e-66 PF00725: 3HCDH" amino acids 181 to 277 (97 residues), 118.2 bits, see alignment E=1.9e-38

Best Hits

Swiss-Prot: 68% identical to HBD_CLOAB: 3-hydroxybutyryl-CoA dehydrogenase (hbd) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 96% identity to fnu:FN1019)

MetaCyc: 68% identical to 3-hydroxybutyryl-CoA dehydrogenase (Clostridium acetobutylicum)
3-hydroxyacyl-CoA dehydrogenase. [EC: 1.1.1.35]

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)" (EC 1.1.1.157, EC 1.1.1.35)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.157 or 1.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>HUW76_05010 3-hydroxybutyryl-CoA dehydrogenase (Fusobacterium nucleatum SB010)
MKVGIIGAGTMGAGIAQAFAQTEGFTVVLCDINNEFAANGKKKIAKGFEKRIAKGKMEQA
AADKILEKITTGTKDICGDCDLIIEAAIENMEIKKQTFKELDDICKPEAIFATNTSSLSI
TEIGSGLKRPIIGMHFFNPAPVMKLVEIIAGLNTPTELVDKIKKVSEDIGKVPVQVQEAP
GFVVNRILIPMINEAVGIYAEGIASVEGIDSAMKLGANHPIGPLALGDLIGLDVCLAIMD
VLYHETGDSKYRAHTLLRKMVRGKQLGQKTGKGFYDYTK