Protein Info for HUW76_04665 in Fusobacterium nucleatum SB010

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00733: Asn_synthase" amino acids 24 to 84 (61 residues), 35.2 bits, see alignment E=3.6e-12 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 25 to 360 (336 residues), 331 bits, see alignment E=3.7e-103 PF03054: tRNA_Me_trans" amino acids 25 to 204 (180 residues), 214.7 bits, see alignment E=3.3e-67 PF02540: NAD_synthase" amino acids 25 to 85 (61 residues), 26.5 bits, see alignment E=1e-09 PF06508: QueC" amino acids 28 to 82 (55 residues), 27 bits, see alignment 8.9e-10 PF20259: tRNA_Me_trans_M" amino acids 220 to 275 (56 residues), 70.1 bits, see alignment E=2.7e-23 PF20258: tRNA_Me_trans_C" amino acids 282 to 360 (79 residues), 42.2 bits, see alignment E=2.5e-14

Best Hits

Swiss-Prot: 91% identical to MNMA1_FUSNN: tRNA-specific 2-thiouridylase MnmA 1 (mnmA1) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 91% identity to fnu:FN0765)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>HUW76_04665 tRNA 2-thiouridine(34) synthase MnmA (Fusobacterium nucleatum SB010)
MIETKNVASKFSKYIEFDSSKKNIKVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKD
EDSDAKKVCDDLGIEHYVLDVRDEFKKKVVDYFVSEYMNGRTPNPCMVCNRHIKFGKMLD
FILSKGASFMATGHYTKLKNGLLSVGDDSNKDQVYFLSQIQKDRLNKIIFPVGDLEKSKL
RELAEQLGVRVYSKKDSQEICFVDDGKLKEFLIENTKGKAEKTGNIVDKDGNILGRHKGF
SFYTIGQRKGLGISSEEPLYVLAFDRETNNIIVGKNEDLFKDELIATRLNLFSVSSLESL
DNLECFAKTRSRDILHKCLLKKDGDNFQVKFIDNKVRAITPGQGIVFYNDEGNVIAGGFI
ER