Protein Info for HUW76_04635 in Fusobacterium nucleatum SB010

Annotation: rod shape-determining protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 12 to 337 (326 residues), 437.7 bits, see alignment E=1.3e-135 PF06723: MreB_Mbl" amino acids 14 to 335 (322 residues), 444.3 bits, see alignment E=4.3e-137 PF00022: Actin" amino acids 39 to 204 (166 residues), 32.1 bits, see alignment E=1e-11 PF00012: HSP70" amino acids 107 to 275 (169 residues), 42.5 bits, see alignment E=5.8e-15 PF14450: FtsA" amino acids 160 to 318 (159 residues), 34.9 bits, see alignment E=3.6e-12

Best Hits

Swiss-Prot: 53% identical to MREB_BACSU: Cell shape-determining protein MreB (mreB) from Bacillus subtilis (strain 168)

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 97% identity to fnu:FN0758)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>HUW76_04635 rod shape-determining protein (Fusobacterium nucleatum SB010)
MKKFLGKILGIFSDDLGIDLGTSNTLICMKNKGIILREPSVVAISTKTKEIFEVGEKAKH
MIGRTPSTYETIRPLRNGVIADYEVTEKMLRCFYRRIKSGTFLNKPRVIICVPAGITQVE
KRAVMEVTREAGAREAYLIEEPMAAAIGVGINIFEPEGSMVVDIGGGTSELAVVSLGGVV
KKSSFRVAGDRFDTAIVDYVRQKHNLLIGEKSAEDIKIKIGTVSPEEEEMEIEVSGKYVL
NGLPKDITLTSSELIETLSTLVQEIIEEIRVVFEKTPPELAADIKKRGIYISGGGALLRG
IDKKISAGLNLKVTIAEDPLNAVINGIGVLLNNFSLYSKVLVSTETEY