Protein Info for HUW76_04530 in Fusobacterium nucleatum SB010

Annotation: toxin-antitoxin system YwqK family antitoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 205 to 226 (22 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details PF07661: MORN_2" amino acids 50 to 70 (21 residues), 17.2 bits, see alignment (E = 2.3e-07) amino acids 73 to 93 (21 residues), 11.4 bits, see alignment (E = 1.7e-05) amino acids 97 to 118 (22 residues), 20.9 bits, see alignment (E = 1.4e-08) amino acids 121 to 142 (22 residues), 22.1 bits, see alignment (E = 5.8e-09)

Best Hits

KEGG orthology group: None (inferred from 74% identity to fnu:FN0738)

Predicted SEED Role

"Phophatidylinositol-4-phosphate 5-kinase (EC 2.7.1.68)" (EC 2.7.1.68)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.68

Use Curated BLAST to search for 2.7.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>HUW76_04530 toxin-antitoxin system YwqK family antitoxin (Fusobacterium nucleatum SB010)
MKKNFIIYTFIIFLLTSFTVFAEREVDFEKLKYDEKTGLVYLEGEKEAFTGIAKQYYEDK
SLKIEFPYKNGKMEGRGKEYYPSGKFKSDAFFVDGLLQGKSTGYYENGNLEYEENYKDGK
LDGLIKEYYENGQVFIQENYKDGELDGESFNFNEDGSFRSKAVYKNGELVGDIIKGETGS
VVAGDVPDTEEVTVPTENENIESKIAIFAFGTVIIGLIAYTIFKIFTAFPKTNHLTDEQR
SRILKILMKYDEGKNGLFSAYRMNGVGTGYYKVRSMMVDNEKVYIYAKMFSILYIPTPIT
LGYLLCYNKDKILASFSNAAFKEAKKEIEETVLHL