Protein Info for HUW76_03975 in Fusobacterium nucleatum SB010

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 6 to 34 (29 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 136 to 162 (27 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 243 to 259 (17 residues), see Phobius details amino acids 279 to 296 (18 residues), see Phobius details amino acids 316 to 346 (31 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 401 to 426 (26 residues), see Phobius details PF06808: DctM" amino acids 7 to 417 (411 residues), 393.2 bits, see alignment E=6.9e-122 TIGR00786: TRAP transporter, DctM subunit" amino acids 18 to 424 (407 residues), 401.4 bits, see alignment E=2e-124

Best Hits

Swiss-Prot: 36% identical to YGIK_SALTY: Uncharacterized protein YgiK (ygiK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 97% identity to fnu:FN1256)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>HUW76_03975 TRAP transporter large permease (Fusobacterium nucleatum SB010)
MEALYPVIVLFVLFFLNIPIAFALMGSALFYFIFLNTTMSMDMVIQQFVTSVESFPYLAV
PFFIMVGSVMNYSGISEELMNMAEVLAGHMKGGLAQVNCLLSAMMGGISGSANADAAMES
KILVPEMIKKGFSKEFSAAVTAASSAVSPVIPPGTNLILYALIANVPVGDMFLAGYTPGI
LMTAAMMVTVYIISKKRGYKPSRERMARPVEILRQAIKSIWALAIPFGIIMGMRIGVFTP
TEAGGVAVFFCFLVGFFIYKKLKLHHIPIILMETVKSTGAVMIIIASAKVFGYYMTLERI
PQFITNSLMNFTDNKLVLLMVINVLLLFVGMFIEGGAALVILAPLLVPAVKELGVDPLHF
GVIFIVNIMIGGLTPPFGSMMFTVCSIVGVRLEAFIKEVWPFIVALLVVLLLVTYSESIA
LFIPNLFLK