Protein Info for HUW76_03935 in Fusobacterium nucleatum SB010

Annotation: sirohydrochlorin cobaltochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06180: CbiK
  • amino acids 4 to 255 (252 residues), 335.3 bits, E=2.4e-104
• PF01903: CbiX
  • amino acids 158 to 246 (89 residues), 22.7 bits, E=1e-08

Best Hits

KEGG orthology group: K02190, sirohydrochlorin cobaltochelatase [EC: 4.99.1.3] (inferred from 93% identity to fnu:FN1263)

Predicted SEED Role

"Sirohydrochlorin cobaltochelatase CbiK (EC 4.99.1.3)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.99.1.3)

MetaCyc Pathways

• adenosylcobalamin biosynthesis I (anaerobic) (31/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
• siroheme biosynthesis (4/4 steps found)
• factor 430 biosynthesis (3/7 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.3

Protein Sequence (273 amino acids)

>HUW76_03935 sirohydrochlorin cobaltochelatase (Fusobacterium nucleatum SB010)
MSKKALFMVHFGTTHNDTKELTIDKMNRKFADEFKDYNLFTAYTSRIVLKKLKDRGEFLS
TPIRVLNSLADQGYEELLVQTSHIIPGIEYENLVREVNSFSNKFKSIKIGKPLLYYIDDY
RKCVEALADEYVPKNKKEALVLVCHGTDSPLATSYAMIEYVFDEYGYDNVFVVCTKAYPL
MDTLIKKLKKAGIEEVRLAPFMFVAGEHAKNDMAVTYKKELEENGFKVNQVILKGLGEFD
AIQNIFLNHLKRAIEKDDEDIADFKKEYSEKYL