Protein Info for HUW76_03935 in Fusobacterium nucleatum SB010

Annotation: sirohydrochlorin cobaltochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF06180: CbiK" amino acids 4 to 255 (252 residues), 335.3 bits, see alignment E=2.4e-104 PF01903: CbiX" amino acids 158 to 246 (89 residues), 22.7 bits, see alignment E=1e-08

Best Hits

KEGG orthology group: K02190, sirohydrochlorin cobaltochelatase [EC: 4.99.1.3] (inferred from 93% identity to fnu:FN1263)

Predicted SEED Role

"Sirohydrochlorin cobaltochelatase CbiK (EC 4.99.1.3)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.99.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>HUW76_03935 sirohydrochlorin cobaltochelatase (Fusobacterium nucleatum SB010)
MSKKALFMVHFGTTHNDTKELTIDKMNRKFADEFKDYNLFTAYTSRIVLKKLKDRGEFLS
TPIRVLNSLADQGYEELLVQTSHIIPGIEYENLVREVNSFSNKFKSIKIGKPLLYYIDDY
RKCVEALADEYVPKNKKEALVLVCHGTDSPLATSYAMIEYVFDEYGYDNVFVVCTKAYPL
MDTLIKKLKKAGIEEVRLAPFMFVAGEHAKNDMAVTYKKELEENGFKVNQVILKGLGEFD
AIQNIFLNHLKRAIEKDDEDIADFKKEYSEKYL