Protein Info for HUW76_03230 in Fusobacterium nucleatum SB010

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF12844: HTH_19" amino acids 5 to 67 (63 residues), 41.8 bits, see alignment E=1.6e-14 PF01381: HTH_3" amino acids 8 to 60 (53 residues), 45.8 bits, see alignment E=1e-15 PF13443: HTH_26" amino acids 8 to 63 (56 residues), 34.6 bits, see alignment E=3.6e-12 PF00717: Peptidase_S24" amino acids 83 to 198 (116 residues), 94.7 bits, see alignment E=6.4e-31

Best Hits

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.88

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>HUW76_03230 helix-turn-helix domain-containing protein (Fusobacterium nucleatum SB010)
MYEIGKKIATFRKERKMSQTDLANELGITKQTIIKYEAEKNSIPIDTLSHIANIFKIPIE
SFFSDNNEYVNEISEKTNFKKIPIISKVSAGLGTFGIDDILDWLKLPTSISKKADFATLI
DGDSMEPKIEDGSLVLVHQNLILDNGDIGIFYLNEEVFCKKFSKDPFTNIITLKSLNKDY
SPIVINEDDDFRIIGKVVGVFDYNI