Protein Info for HUW76_03150 in Fusobacterium nucleatum SB010

Annotation: signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 5 to 24 (20 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details PF10502: Peptidase_S26" amino acids 89 to 202 (114 residues), 95.6 bits, see alignment E=1.7e-31 amino acids 321 to 363 (43 residues), 39.6 bits, see alignment 2.6e-14 TIGR02227: signal peptidase I" amino acids 90 to 216 (127 residues), 86.4 bits, see alignment E=9.8e-29

Best Hits

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>HUW76_03150 signal peptidase I (Fusobacterium nucleatum SB010)
MSTKFWNCAAIFLIVVTLLIVLKFFATKTIFYGVFYFFLTLFFIYIFVKEKDLAKISDAR
REKYVSKIVKKYDIKNENKIKNIKKVFYYIETIGTALILVVIIQRFYIGNFKIPTGSMIP
TIQIGDRVFADMVSYKFTTPKRNSIIVFEEPMRDEDLYTKRAMGLPGERIKIENDTLYIN
GEKTNFRRYSDNGIGSQEWRIPQKGDKLQIIPAGNYREVFEDAGINVDDIVKEAFYKESF
EFFKNIYYNLKHKIFDKLNIKYDITEYTNHRNDYRKQGAFSIVGMIMPNLKFIVNGEETG
PILDFISDKDIRNKLLNGETVEIILDDNYYLALGDNTDNSQDSRYIGFIKESRIRGRALV
RFWPLNRIGLIKEPQQNEVINTLVQTIKNLKVNIDKKFLEKTNDNKINK