Protein Info for HUW76_03135 in Fusobacterium nucleatum SB010

Annotation: Gx transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 10 to 29 (20 residues), see Phobius details amino acids 35 to 49 (15 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details PF07456: Hpre_diP_synt_I" amino acids 15 to 164 (150 residues), 133.5 bits, see alignment E=3e-43

Best Hits

KEGG orthology group: K00805, heptaprenyl diphosphate synthase [EC: 2.5.1.30] (inferred from 95% identity to fnu:FN0367)

Predicted SEED Role

"Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)" in subsystem Polyprenyl Diphosphate Biosynthesis or Sex pheromones in Enterococcus faecalis and other Firmicutes (EC 2.5.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.30

Use Curated BLAST to search for 2.5.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>HUW76_03135 Gx transporter family protein (Fusobacterium nucleatum SB010)
MIKREYREEIYLIALVLLGLYLSLIENIIPKPFPWMKIGLSNISVLIALEKFNSKMALQT
ILLRVFIQALMLGTLFTPNFIISFSAGLVSTLFMIFLYKFRKYLSLLSISCISAFTHNLL
QLIVVYFLLFRNISLNSKSIIIFIVIFLGLGVIMGLITGVIATKINLKRKKI