Protein Info for HUW76_03035 in Fusobacterium nucleatum SB010

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00163: phosphatidylserine decarboxylase
  • amino acids 83 to 285 (203 residues), 148.1 bits, E=1.2e-47
• PF02666: PS_Dcarbxylase
  • amino acids 90 to 296 (207 residues), 226.8 bits, E=1e-71

Best Hits

Swiss-Prot: 92% identical to PSD_FUSNN: Phosphatidylserine decarboxylase proenzyme (psd) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 92% identity to fnu:FN0347)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of cardiolipin biosynthesis (bacteria) (11/13 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Protein Sequence (300 amino acids)

>HUW76_03035 phosphatidylserine decarboxylase (Fusobacterium nucleatum SB010)
MKFEKIKYIERKTGEIKTEKVMGEGALKFLYYNPFGKLALHTIVKRKFLSDWYGRKMSKP
ESKEKIKSFVEEMGIDMNEYKRPIEDYTSFNDFFYRELKDGARKIDYNENVVVSPADGKI
LAFENIKEVDTFFVKGSEFTLEEFFNDKELAKKYKDGTFVIIRLAPADYHRFHFPVDGEI
SEVKKISGDYYSVSTHAIKTNFRIFCENKREYAILKTKKFGDIAMFDIGATMVGAIVQTY
KANSFVKKGEEKGYFLFGGSTCILIFEKGKVIIDKDIIENTQNKIETRIYMGEKFGNEKN