Protein Info for HUW76_02250 in Fusobacterium nucleatum SB010

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR02191: ribonuclease III" amino acids 7 to 225 (219 residues), 250.5 bits, see alignment E=6.7e-79 PF14622: Ribonucleas_3_3" amino acids 17 to 146 (130 residues), 127.8 bits, see alignment E=4.4e-41 PF00636: Ribonuclease_3" amino acids 43 to 132 (90 residues), 82.2 bits, see alignment E=6.2e-27 PF00035: dsrm" amino acids 162 to 226 (65 residues), 45.3 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 94% identical to RNC_FUSNN: Ribonuclease 3 (rnc) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 94% identity to fnu:FN0152)

MetaCyc: 35% identical to RNase III (Escherichia coli K-12 substr. MG1655)
Ribonuclease III. [EC: 3.1.26.3]

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>HUW76_02250 ribonuclease III (Fusobacterium nucleatum SB010)
MKNLLDLEHKLNYYFNDRNLLKNALLHKSLGNERKEYKNQNNERLELLGDAVLDLIVAEY
LYKSYKNASEGTIAKLKAMIVSEPILAKISRQIGVGKFLMLSRGEIMSGGRNRESILADS
FEAILGAVYIDSNLDDARNFTLSHIKQYIDHIEENEDILDFKSILQEYVQKEFRTVPTYK
LIAERGPDHMKEFEIQVIVGNYREKAVAKNKKKAEQLSAKALCIKLGVNYHEAL