Protein Info for HUW76_02240 in Fusobacterium nucleatum SB010

Annotation: acyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00517: acyl carrier protein
  • amino acids 2 to 73 (72 residues), 115.6 bits, E=3.7e-38
• PF00550: PP-binding
  • amino acids 3 to 70 (68 residues), 68.4 bits, E=2.5e-23

Best Hits

Swiss-Prot: 99% identical to ACP_FUSNN: Acyl carrier protein (acpP) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K02078, acyl carrier protein (inferred from 99% identity to fnu:FN0150)

MetaCyc: 61% identical to acyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Acyl carrier protein" in subsystem Fatty Acid Biosynthesis FASII or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or mycolic acid synthesis

Protein Sequence (75 amino acids)

>HUW76_02240 acyl carrier protein (Fusobacterium nucleatum SB010)
MLDKVKEIIVEQLGVDADQIKPESNFVDDLGADSLDTVELIMSFEEEFGVEIPDTEAEKI
KTVQDVINYIEAHKK